PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g096380.4
Common NameMTR_2g096380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 218aa    MW: 25033.2 Da    PI: 6.8754
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g096380.4genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-164287148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T+ E+ l +++  ++G++ W++Iar+++ gRt++++k++w++++
  Medtr2g096380.4 42 RGKMTPHEERLVLELQSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 87
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.85E-222292IPR009057Homeodomain-like
PROSITE profilePS500904.4262236IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.8E-92248IPR009057Homeodomain-like
PROSITE profilePS5129425.7993791IPR017930Myb domain
SMARTSM007178.6E-164189IPR001005SANT/Myb domain
PfamPF002495.9E-144286IPR001005SANT/Myb domain
CDDcd001671.50E-114487No hitNo description
Gene3DG3DSA:1.10.10.604.4E-194988IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MIVYVTSNLL SLTILIFVVG LNRTGKSCRL RWVNYLHPGL KRGKMTPHEE RLVLELQSKW  60
GNRWSRIARK LPGRTDNEIK NYWRTHMRKK AQDKKRGSIQ STEHHVMNSH ASKEAGEESF  120
YDTGGSSTST QVKLVGEEHE KEISMDDIWK DIDLSEENSL QNEECCNINN NISCLPKTSS  180
SWEYNSTDSL WVMGEESMLF PMAPMSDDPY FSGYANY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-17239137105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.5330.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1495760.0BT149576.1 Medicago truncatula clone JCVI-FLMt-17K5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597328.21e-163myb transcription factor
SwissprotQ9LX821e-60MYB48_ARATH; Transcription factor MYB48
TrEMBLG7IHL61e-163G7IHL6_MEDTR; Myb transcription factor
STRINGGLYMA15G04620.19e-81(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.41e-62myb domain protein 48
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]